Pay in 4 interest-free payments of $26.25 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
RRID: AB_2846995
E-EL-H1651-48
AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Mutations in this gene cause Aicardi-Goutieres Syndrome (AGS)
Specificity: NFX1 Polyclonal Antibody detects endogenous levels of NFX1 protein
Human UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit - E-EL-H2377 Size:96T RRID: AB_2846995Human UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit Sizes: 24T, 48T, 96T Catalogue Numbers: E EL H2377 24, E EL H2377 48, E EL H2377 96 Citations, Manuals and MSDS Available upon request. Abbreviation: UCHL1 UNIProt ID: P09936 Research Areas: Cancer, Cell Biology, Neuroscience, Tags and Cell Markers Target Species: Human Application: ELISA Usage: This ELISA kit applies to the in vitro quantitative determination of Human UCHL1
US$ 108.50
US$ 18.00
US$ 14.00
US$ 10.00
US$ 22.00
US$ 18.00